PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR08G03020.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family MYB
Protein Properties Length: 353aa    MW: 38799.3 Da    PI: 6.432
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR08G03020.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.42.8e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg W++eEde+l+++++ +G g+W+ ++++ g+ R++k+c++rw +yl
  LPERR08G03020.1 14 RGLWSPEEDEKLIRYITTHGYGCWSEVPEKAGLQRCGKSCRLRWINYL 61
                     788*******************************************97 PP

2Myb_DNA-binding54.23.4e-1767111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rgr+++eE++l++ +++  G++ W+ Ia++++ gRt++++k++w+++
  LPERR08G03020.1  67 RGRFSAEEEKLIISLHAIVGNR-WAHIASHLP-GRTDNEIKNYWNSW 111
                      89********************.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.0E-25664IPR009057Homeodomain-like
PROSITE profilePS5129417.264961IPR017930Myb domain
SuperFamilySSF466891.8E-2911108IPR009057Homeodomain-like
SMARTSM007171.9E-121363IPR001005SANT/Myb domain
PfamPF002492.8E-151461IPR001005SANT/Myb domain
CDDcd001672.32E-111761No hitNo description
PROSITE profilePS5129425.4962116IPR017930Myb domain
Gene3DG3DSA:1.10.10.609.0E-2565116IPR009057Homeodomain-like
SMARTSM007174.4E-1766114IPR001005SANT/Myb domain
PfamPF002498.4E-1667111IPR001005SANT/Myb domain
CDDcd001672.18E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:1901430Biological Processpositive regulation of syringal lignin biosynthetic process
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 353 aa     Download sequence    Send to blast
MGHHSCCNQQ KVKRGLWSPE EDEKLIRYIT THGYGCWSEV PEKAGLQRCG KSCRLRWINY  60
LRPDIRRGRF SAEEEKLIIS LHAIVGNRWA HIASHLPGRT DNEIKNYWNS WIKKKIRKPP  120
AAVSTTTSSA SVTTTTSPNN NNPPPPCSTA TSDHQATPFA PAFAGATAAT DHHQLQLDAI  180
INHNLLSLPP KLAAGDSHHC PLFMFDTVSP PSPSPALIPT HHHHPFIASF TAAMSAAADT  240
PISYLPPLID GMVDNIGSSI DDDASNHHSN QVAAGMGNCN GGGGGGCHGL MYEQMNEKQM  300
ELGEEQEQNN QWDEEEAEHL LMWDQEVLTS SNLEVMQSGA HHSLLFMGPN HHD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-27141167108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1118081e-147AK111808.1 Oryza sativa Japonica Group cDNA clone:J013114D05, full insert sequence.
GenBankAK1121171e-147AK112117.1 Oryza sativa Japonica Group cDNA clone:002-129-C03, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015648990.11e-146PREDICTED: protein rough sheath 2
TrEMBLA0A0D9X4E50.0A0A0D9X4E5_9ORYZ; Uncharacterized protein
STRINGBGIOSGA027659-PA1e-146(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP60323757
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G63910.11e-83myb domain protein 103